Request QuoteCatalog Number: xP020253DOSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L36a (Rpl36a)

Recombinant 60S ribosomal protein L36a (Rpl36a) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020253DOYeast1mgQuote
EP020253DOE. coli1mgQuote
BP020253DOBaculovirus200ugQuote
MP020253DOMammalian Cell200ugQuote

Protein Information

SpeciesCanis familiaris (Dog) (Canis lupus familiaris)
UniProt IDD0VWQ4
Gene NameRpl36a; aka: Rpl44
Protein Name60S ribosomal protein L36a
Region Expressed2-106
Expression Tag6xHis
Purity>90%
AA SequenceVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAK TTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review