Request QuoteCatalog Number: xP020342LOESize: 0.2-1mg

Request Quote

Recombinant 60S acidic ribosomal protein P2 (ARP-1)

Recombinant 60S acidic ribosomal protein P2 (ARP-1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020342LOEYeast1mgQuote
EP020342LOEE. coli1mgQuote
BP020342LOEBaculovirus200ugQuote
MP020342LOEMammalian Cell200ugQuote

Protein Information

SpeciesLeishmania donovani
UniProt IDO43940
Gene NameARP-1
Protein Name60S acidic ribosomal protein P2
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMQYLAAYALVALSGKTPSKAAVEAVLKAAGVAVDASRVDAVFQELEGKSFDALVAEGRAK LVGSGSAAPAAAASTAAAAAAVVAEAKKEEPEEEADDDMGFGLFD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review