Request QuoteCatalog Number: xP309839FPMSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L18e (rpl18e)

Recombinant 50S ribosomal protein L18e (rpl18e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP309839FPMYeast1mgQuote
EP309839FPME. coli1mgQuote
BP309839FPMBaculovirus200ugQuote
MP309839FPMMammalian Cell200ugQuote

Protein Information

SpeciesSulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
UniProt IDP95990
Gene Namerpl18e; Locus:SSO0070; ORFs:C05001, C05_040
Protein Name50S ribosomal protein L18e
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMKVTGSTNITVRKLIRNLEKSKKPLWRKVAEELSIPSRKRPYINLYKINEHTKPNDIVVV PGKVLGIGKLDHEVTVIALDFSKSAIEKIRASGGQAMSIYKALETFKDFKGRSVRLMKQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review