Request QuoteCatalog Number: xP304228MLWSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L19 (rplS)

Recombinant 50S ribosomal protein L19 (rplS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP304228MLWYeast1mgQuote
EP304228MLWE. coli1mgQuote
BP304228MLWBaculovirus200ugQuote
MP304228MLWMammalian Cell200ugQuote

Protein Information

SpeciesMycoplasma pneumoniae (strain ATCC 29342 / M129)
UniProt IDP75133
Gene NamerplS; Locus:MPN_658; ORFs:MP184
Protein Name50S ribosomal protein L19
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMKKINKQALIDLVEQKQLKAYVPEFSAGDEVNVAIKLKEKEKVRIQNFTGTVLRRRGKGI SETFIVRKTTDGIPIEKNFQIHNPNISIELKRRGKVRRAYISYMRERSGKAAKIKERKQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review