Request QuoteCatalog Number: xP300364SSQSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L25 (rplY)

Recombinant 50S ribosomal protein L25 (rplY) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP300364SSQYeast1mgQuote
EP300364SSQE. coli1mgQuote
BP300364SSQBaculovirus200ugQuote
MP300364SSQMammalian Cell200ugQuote

Protein Information

SpeciesSynechocystis sp. (strain PCC 6803 / Kazusa)
UniProt IDP73289
Gene NamerplY; Locus:sll1824
Protein Name50S ribosomal protein L25
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMALSIECQQRPEKVNPRALRREGLIPATLYGHNGAESISLVVDHKTAITMLRSVTVKETP IEVKIPHLSWEGEAVVQEIQCHPWRRNLYHLAFFAGKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review