Request QuoteCatalog Number: xP302755MLWSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L27 (rpmA)

Recombinant 50S ribosomal protein L27 (rpmA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP302755MLWYeast1mgQuote
EP302755MLWE. coli1mgQuote
BP302755MLWBaculovirus200ugQuote
MP302755MLWMammalian Cell200ugQuote

Protein Information

SpeciesMycoplasma pneumoniae (strain ATCC 29342 / M129)
UniProt IDP75458
Gene NamerpmA; Locus:MPN_327; ORFs:MP509
Protein Name50S ribosomal protein L27
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMNNKYFLTKIDLQFFASKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVY PGVNVGLGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKLDA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review