Request QuoteCatalog Number: xP524830FHXSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L21e (rpl21e)

Recombinant 50S ribosomal protein L21e (rpl21e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524830FHXYeast1mgQuote
EP524830FHXE. coli1mgQuote
BP524830FHXBaculovirus200ugQuote
MP524830FHXMammalian Cell200ugQuote

Protein Information

SpeciesPyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
UniProt IDO74001
Gene Namerpl21e; Locus:PH1127.1; ORFs:PHS032
Protein Name50S ribosomal protein L21e
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMVQKPHSFRRKTRKKLRKHPRRRGLPPLTRFLQEFEVGQKVHIVIEPSYHKGMPDPRFHG RTGTVVGKRGDAYIVEVPDGNKVKTLFIHPVHLRPQK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review