Request QuoteCatalog Number: xP528184TPRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L21 (rplU)

Recombinant 50S ribosomal protein L21 (rplU) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP528184TPRYeast1mgQuote
EP528184TPRE. coli1mgQuote
BP528184TPRBaculovirus200ugQuote
MP528184TPRMammalian Cell200ugQuote

Protein Information

SpeciesTreponema pallidum (strain Nichols)
UniProt IDO83727
Gene NamerplU; Locus:TP_0745
Protein Name50S ribosomal protein L21
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMYALIEYKGKQYKVERGSSIVVDNISEVAPGGCIDVREVLMIGGEGLTRIGSPYLEGVGV RAVVGECFRSRKITVYKYKSKKDYHRTIGHRQWYTRLTVSDILGV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review