Request QuoteCatalog Number: xP529776FKMSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L22, chloroplastic (rpl22)

Recombinant 50S ribosomal protein L22, chloroplastic (rpl22) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529776FKMYeast1mgQuote
EP529776FKME. coli1mgQuote
BP529776FKMBaculovirus200ugQuote
MP529776FKMMammalian Cell200ugQuote

Protein Information

SpeciesSpirogyra maxima (Green alga)
UniProt IDO98454
Gene Namerpl22
Protein Name50S ribosomal protein L22, chloroplastic
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMIQMNDSKLEVLALGKNIRMSPHKVRKVIDQIRGRSYEEALMLLTFMPYRACDPILKVVC SAAANASHNFGFRKSTLYISEAKVDKGPLFKRFRPRAQGRGFPISKPTCYITIVITSRT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review