Request QuoteCatalog Number: xP529775TMASize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L19, chloroplastic (rpl19)

Recombinant 50S ribosomal protein L19, chloroplastic (rpl19) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529775TMAYeast1mgQuote
EP529775TMAE. coli1mgQuote
BP529775TMABaculovirus200ugQuote
MP529775TMAMammalian Cell200ugQuote

Protein Information

SpeciesThalassiosira weissflogii (Marine diatom)
UniProt IDO98449
Gene Namerpl19
Protein Name50S ribosomal protein L19, chloroplastic
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMLNLDNQKAIDNLHKNFIKPNLPKIQIGDTVKLGVKIIEGNKERVQFYEGTVIAKKNSSI NTTITVRKVLQGIGIERIFLIHSPKIASIEVLRHSKVRRSKLYYLRNLRGKASRLKQRFE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review