Request QuoteCatalog Number: xP511995GFRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L23 (rplW)

Recombinant 50S ribosomal protein L23 (rplW) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511995GFRYeast1mgQuote
EP511995GFRE. coli1mgQuote
BP511995GFRBaculovirus200ugQuote
MP511995GFRMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter sp. (strain M21)
UniProt IDC6E4Q5
Gene NamerplW; Locus:GM21_3326
Protein Name50S ribosomal protein L23
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMNIYDVIKKPLITEKTTVEKDDKNVIAFVVNGAANKIEIKAAVEKLFNAQVSAVNTVNVA GKTKRTAKGIGKRSNWKKAYVTLKEGSNVDFFEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review