Request QuoteCatalog Number: xP513072GFRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L22 (rplV)

Recombinant 50S ribosomal protein L22 (rplV) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513072GFRYeast1mgQuote
EP513072GFRE. coli1mgQuote
BP513072GFRBaculovirus200ugQuote
MP513072GFRMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter sp. (strain M21)
UniProt IDC6E4Q2
Gene NamerplV; Locus:GM21_3323
Protein Name50S ribosomal protein L22
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMESSAKLSSVRLSPRKTRLVVDLVRGKGIQTALNTLRFSPQPSAKLISKLLSSAVANAEQ KGCSDVDKLFVKTIFVDGGAVLKRFTPRAMGRASKIRKPTSHITVVLAEKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review