Request QuoteCatalog Number: xP509731GFRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L24 (rplX)

Recombinant 50S ribosomal protein L24 (rplX) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509731GFRYeast1mgQuote
EP509731GFRE. coli1mgQuote
BP509731GFRBaculovirus200ugQuote
MP509731GFRMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter sp. (strain M21)
UniProt IDC6E4P6
Gene NamerplX; Locus:GM21_3317
Protein Name50S ribosomal protein L24
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMLGKKLHVKKNDTVVVIAGKDRSKSGKVISIHPKKDGVIVEGVNVVKRHQKPRGSEQGGI LEKEAPVHISNVMLLCGKCNKPVRTKTTVLEDGKKARCCVKCGESFDK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review