Request QuoteCatalog Number: xP513024ESQSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L20 (rplT)

Recombinant 50S ribosomal protein L20 (rplT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513024ESQYeast1mgQuote
EP513024ESQE. coli1mgQuote
BP513024ESQBaculovirus200ugQuote
MP513024ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DFY9
Gene NamerplT; Locus:PC1_1891
Protein Name50S ribosomal protein L20
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKLAFSALVEKAKAALA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review