Request QuoteCatalog Number: xP514787ESQSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L19 (rplS)

Recombinant 50S ribosomal protein L19 (rplS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514787ESQYeast1mgQuote
EP514787ESQE. coli1mgQuote
BP514787ESQBaculovirus200ugQuote
MP514787ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DCP8
Gene NamerplS; Locus:PC1_3200
Protein Name50S ribosomal protein L19
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMSNIIKQIEDEQMKQDVPAFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHSAFT VRKISNGEGVERVFQTHSPVVDSIAVKRRGAVRKAKLYYLRERTGKSARIKERLN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review