Request QuoteCatalog Number: xP514759DJQSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L22 (rplV)

Recombinant 50S ribosomal protein L22 (rplV) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514759DJQYeast1mgQuote
EP514759DJQE. coli1mgQuote
BP514759DJQBaculovirus200ugQuote
MP514759DJQMammalian Cell200ugQuote

Protein Information

SpeciesDesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
UniProt IDC6C190
Gene NamerplV; Locus:Desal_1190
Protein Name50S ribosomal protein L22
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMEARAIAKYMRISPRKVRLVAENIKGKPVEEALNILKFTPKKGAEMLSKVLYSAVANAEQ IPGVDVDSLCVDIVKVDEGPTWKRIQPRAMGRAYRIRKRTSHITVVVKEM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review