Request QuoteCatalog Number: xP513273EOXSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L27 (rpmA)

Recombinant 50S ribosomal protein L27 (rpmA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513273EOXYeast1mgQuote
EP513273EOXE. coli1mgQuote
BP513273EOXBaculovirus200ugQuote
MP513273EOXMammalian Cell200ugQuote

Protein Information

SpeciesEubacterium rectale (strain ATCC 33656 / VPI 0990)
UniProt IDC4Z9Z8
Gene NamerpmA; Locus:EUBREC_1695
Protein Name50S ribosomal protein L27
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMLNMNLQFFAHKKGVGSTKNGRDSESKRLGAKRADGQFVKAGNILYRQRGTKIHPGTNVG IGGDDTLYAKVDGVLRFERVGRDKKQASVYPVVNE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review