Request QuoteCatalog Number: xP519960FKOSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L22 (rplV)

Recombinant 50S ribosomal protein L22 (rplV) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP519960FKOYeast1mgQuote
EP519960FKOE. coli1mgQuote
BP519960FKOBaculovirus200ugQuote
MP519960FKOMammalian Cell200ugQuote

Protein Information

SpeciesSpiroplasma citri
UniProt IDO31160
Gene NamerplV
Protein Name50S ribosomal protein L22
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMDVRANLRSIRISPRKVRLVTDLIRNKKVGDAIVILNNTNKKSSVPVQKLVKSAESIAVN NNGLDADRLFIKEIFVNERPTLKRFRPRAHGRAYEILKRTSHITVTVSDGQQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review