Request QuoteCatalog Number: xP514388ENUSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L18 (rplR)

Recombinant 50S ribosomal protein L18 (rplR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514388ENUYeast1mgQuote
EP514388ENUE. coli1mgQuote
BP514388ENUBaculovirus200ugQuote
MP514388ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZUF9
Gene NamerplR; Locus:BWG_2995
Protein Name50S ribosomal protein L18
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMDKKSARIRRATRARRKLQELGATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAIAE QLKYTGNKDAAAAVGKAVAERALEKGIKDVSFDRSGFQYHGRVQALADAAREAGLQF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review