Request QuoteCatalog Number: xP510346DJQSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L20 (rplT)

Recombinant 50S ribosomal protein L20 (rplT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510346DJQYeast1mgQuote
EP510346DJQE. coli1mgQuote
BP510346DJQBaculovirus200ugQuote
MP510346DJQMammalian Cell200ugQuote

Protein Information

SpeciesDesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
UniProt IDC6BRG8
Gene NamerplT; Locus:Desal_1346
Protein Name50S ribosomal protein L20
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMRVKRGVAAKRRHKKYLKMAKGFRGSGSTLYRTARERVERSLCMAYVGRKLRKRDMRKLW IQRINAAARLNGMSYSRLIHGLSTAGVTLNRKVLADLAVNDAPAFAKVVEIAKAQVS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review