Request QuoteCatalog Number: xP520448BRMSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L24 (rplX)

Recombinant 50S ribosomal protein L24 (rplX) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520448BRMYeast1mgQuote
EP520448BRME. coli1mgQuote
BP520448BRMBaculovirus200ugQuote
MP520448BRMMammalian Cell200ugQuote

Protein Information

SpeciesBacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
UniProt IDE0TZF9
Gene NamerplX; Locus:BSUW23_00645
Protein Name50S ribosomal protein L24
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQE APIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review