Request QuoteCatalog Number: xP504609EPUSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L24 (rplX)

Recombinant 50S ribosomal protein L24 (rplX) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504609EPUYeast1mgQuote
EP504609EPUE. coli1mgQuote
BP504609EPUBaculovirus200ugQuote
MP504609EPUMammalian Cell200ugQuote

Protein Information

SpeciesExiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
UniProt IDC4KZN5
Gene NamerplX; Locus:EAT1b_1622
Protein Name50S ribosomal protein L24
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMHVKKGDTVQVMSGKDKGKQGVILKAMPSKNRVVVEGVNVMKKHAKPSQANPQGGILEIE APIHVSNVMPLDPKTGKPTRVGFKVVDGKKVRVAKSGESLDK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review