Request QuoteCatalog Number: xP020407CXYSize: 0.2-1mg

Request Quote

Recombinant 40S ribosomal protein S26 (rps-26)

Recombinant 40S ribosomal protein S26 (rps-26) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020407CXYYeast1mgQuote
EP020407CXYE. coli1mgQuote
BP020407CXYBaculovirus200ugQuote
MP020407CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDO45499
Gene Namerps-26; ORFs:F39B2.6
Protein Name40S ribosomal protein S26
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYT QYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRFGQRAAAARPGAPGPRP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review