Request QuoteCatalog Number: xP020407HUSize: 0.2-1mg

Request Quote

Recombinant 40S ribosomal protein S26 (RPS26)

Recombinant 40S ribosomal protein S26 (RPS26) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020407HUYeast1mgQuote
EP020407HUE. coli1mgQuote
BP020407HUBaculovirus200ugQuote
MP020407HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP62854
Gene NameRPS26
Protein Name40S ribosomal protein S26
Region Expressed2-115
Expression Tag6xHis
Purity>90%
AA SequenceTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDA YVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review