Request QuoteCatalog Number: xP524920SVGSize: 0.2-1mg

Request Quote

Recombinant 37S ribosomal protein MRP10, mitochondrial (MRP10)

Recombinant 37S ribosomal protein MRP10, mitochondrial (MRP10) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524920SVGYeast1mgQuote
EP524920SVGE. coli1mgQuote
BP524920SVGBaculovirus200ugQuote
MP524920SVGMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
UniProt IDO75012
Gene NameMRP10; Locus:YDL045W-A
Protein Name37S ribosomal protein MRP10, mitochondrial
Region Expressed2-95
Expression Tag6xHis
Purity>90%
AA SequenceSGKPPVYRLPPLPRLKVKKPIIRQEANKCLVLMSNLLQCWSSYGHMSPKCAGLVTELKSC TSESALGKRNNVQKSNINYHAARLYDRINGKPHD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review