Request QuoteCatalog Number: xP526758SXVSize: 0.2-1mg

Request Quote

Recombinant 37S ribosomal protein subunit S8, mitochondrial (mrps8)

Recombinant 37S ribosomal protein subunit S8, mitochondrial (mrps8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526758SXVYeast1mgQuote
EP526758SXVE. coli1mgQuote
BP526758SXVBaculovirus200ugQuote
MP526758SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO74956
Gene Namemrps8; ORFs:SPCC736.10c
Protein Name37S ribosomal protein subunit S8, mitochondrial
Region Expressed49-152
Expression Tag6xHis
Purity>90%
AA SequenceDIHGPDALPTITTRQNVATRRLWLGLKYFEGKPVLHYIRAVSKPSRKVNLTPSELLQFAK GRKVSFVNGLEPAEVGIVETKHGIMSIDDAIKNNLGGNVICRVK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review