Request QuoteCatalog Number: xP340941TNDSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10P (rps10p)

Recombinant 30S ribosomal protein S10P (rps10p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340941TNDYeast1mgQuote
EP340941TNDE. coli1mgQuote
BP340941TNDBaculovirus200ugQuote
MP340941TNDMammalian Cell200ugQuote

Protein Information

SpeciesThermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
UniProt IDP28079
Gene Namerps10p; Locus:Ta0445
Protein Name30S ribosomal protein S10P
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMVSYKARISLSGTEHRVVDRVCNEIKEIASRTGVEIHGPMPLPTKRLVVPVRKSPDGEGT NTWDHWEMRIHKRLIDVDADERTLRQLMRIPIPDGVQIEIQIKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review