Request QuoteCatalog Number: xP506218DIYSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S18 (rpsR)

Recombinant 30S ribosomal protein S18 (rpsR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP506218DIYYeast1mgQuote
EP506218DIYE. coli1mgQuote
BP506218DIYBaculovirus200ugQuote
MP506218DIYMammalian Cell200ugQuote

Protein Information

SpeciesDeinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923)
UniProt IDC1CXK0
Gene NamerpsR; Locus:Deide_00110
Protein Name30S ribosomal protein S18
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMTQQSNSADRKPRGKGPKRPRKPKVDPFSIGELEITDYKDVKMLRRFVSDTGKILPRRRT GLSAKHQRRIAQTIKVARQLALLPYTEKLVRK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review