Request QuoteCatalog Number: xP505658EOWSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505658EOWYeast1mgQuote
EP505658EOWE. coli1mgQuote
BP505658EOWBaculovirus200ugQuote
MP505658EOWMammalian Cell200ugQuote

Protein Information

SpeciesEubacterium eligens (strain ATCC 27750 / VPI C15-48)
UniProt IDC4Z2S9
Gene NamerpsJ; Locus:EUBELI_00298
Protein Name30S ribosomal protein S10
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMANQVIRITLKAYDHQLIDQSAKKIIETAKKTGAQVSGPVPLPTKKEVVTILRAVHKYKD SREQFEQRTHKRLIDVLSPSQKTVDALSKLEMPAGVFINLKVMN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review