Request QuoteCatalog Number: xP505326DJPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6 (rpsF)

Recombinant 30S ribosomal protein S6 (rpsF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505326DJPYeast1mgQuote
EP505326DJPE. coli1mgQuote
BP505326DJPBaculovirus200ugQuote
MP505326DJPMammalian Cell200ugQuote

Protein Information

SpeciesDesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
UniProt IDC4XGN7
Gene NamerpsF; Locus:DMR_27040
Protein Name30S ribosomal protein S6
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMRKYEALLLLSPELATDNRQEIVENLKGVLERQGTTMLSVDEWGMKDLAYPVQKKTRGHY TRFEFAAPATAIAEFERIVRITDGVMKFITVKLADKYVPEGA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review