Request QuoteCatalog Number: xP505199DWZSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505199DWZYeast1mgQuote
EP505199DWZE. coli1mgQuote
BP505199DWZBaculovirus200ugQuote
MP505199DWZMammalian Cell200ugQuote

Protein Information

SpeciesCorynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717)
UniProt IDC4LL48
Gene NamerpsS; Locus:ckrop_1833
Protein Name30S ribosomal protein S19
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMPRSLKKGPFVDEHLLSKVDAQNDKGTKQVIKTWSRRSTILPDFIGHTFAVHDGRKHVPV FIDDSMVGHKLGEFAPTKTFKGHVKDDKKGRR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review