Request QuoteCatalog Number: xP492041DULSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492041DULYeast1mgQuote
EP492041DULE. coli1mgQuote
BP492041DULBaculovirus200ugQuote
MP492041DULMammalian Cell200ugQuote

Protein Information

SpeciesClostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
UniProt IDB8I7Y3
Gene NamerpsS; Locus:Ccel_0762
Protein Name30S ribosomal protein S19
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMSRSVKKGPYVLDSLLKKIEEMNKANDKKVIKTWSRASTIFPQMVGHTIAVHDGKKHVPV YITEDMVGHKLGEFAPTRTYKGHSGNEKSTSLR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review