Request QuoteCatalog Number: xP519850DOCSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S24e (rps24e)

Recombinant 30S ribosomal protein S24e (rps24e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP519850DOCYeast1mgQuote
EP519850DOCE. coli1mgQuote
BP519850DOCBaculovirus200ugQuote
MP519850DOCMammalian Cell200ugQuote

Protein Information

SpeciesArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
UniProt IDO29151
Gene Namerps24e; Locus:AF_1114
Protein Name30S ribosomal protein S24e
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMIDLEVYVEKERHNPLLRRREVYCRLSFEGKTPSRKEVRGKIAGLMNAEPERVVVDYIKT EFGKTEAKCYVKIYDTVEDLQKIEEEHIIERNKVEEQAEEAEEAEAGAAE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review