Request QuoteCatalog Number: xP509411MTPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6 (rpsF)

Recombinant 30S ribosomal protein S6 (rpsF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509411MTPYeast1mgQuote
EP509411MTPE. coli1mgQuote
BP509411MTPBaculovirus200ugQuote
MP509411MTPMammalian Cell200ugQuote

Protein Information

SpeciesMicrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
UniProt IDC5C7V1
Gene NamerpsF; Locus:Mlut_23260
Protein Name30S ribosomal protein S6
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMRAYELMVLIDPEVDERTVEPTLKKYLEVVTNAGGTVDNIDVWGRRKTAYEIQKKSEAIY VVVNFQSEPAATQELDRLLNLNETILRTKIIRPEEQKITAE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review