Request QuoteCatalog Number: xP510920TLRSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S13 (rpsM)

Recombinant 30S ribosomal protein S13 (rpsM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510920TLRYeast1mgQuote
EP510920TLRE. coli1mgQuote
BP510920TLRBaculovirus200ugQuote
MP510920TLRMammalian Cell200ugQuote

Protein Information

SpeciesTeredinibacter turnerae (strain ATCC 39867 / T7901)
UniProt IDC5BQ83
Gene NamerpsM; Locus:TERTU_0930
Protein Name30S ribosomal protein S13
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMARIAGVNIPDHKHAVISLTYVFGIGKTTAKQICAATGVAESTKISALDDAKMDEIRAEV AKHTVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPVRGQRSKTNARTRKGPRKPIKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review