Request QuoteCatalog Number: xP496624FMISize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP496624FMIYeast1mgQuote
EP496624FMIE. coli1mgQuote
BP496624FMIBaculovirus200ugQuote
MP496624FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0M751
Gene NamerpsP; Locus:SEQ_1308
Protein Name30S ribosomal protein S16
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQVTLKEDRVLDWL GKGAQPSDTVRSLLSKAGVMAKFHDQKFSK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review