Request QuoteCatalog Number: xP519862DOCSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10P (rps10p)

Recombinant 30S ribosomal protein S10P (rps10p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP519862DOCYeast1mgQuote
EP519862DOCE. coli1mgQuote
BP519862DOCBaculovirus200ugQuote
MP519862DOCMammalian Cell200ugQuote

Protein Information

SpeciesArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
UniProt IDO29324
Gene Namerps10p; Locus:AF_0938
Protein Name30S ribosomal protein S10P
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMPIKGPKARIKLSGLNPRELDRICSQIKEIANKTGVELSGPVPLPTRRMVVPVRKAPDGE GSETWDHWEMRVHKRLIDISADERALRQIMRIQVPRDVNIEIVLES
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review