Request QuoteCatalog Number: xP492634DOGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6 (rpsF)

Recombinant 30S ribosomal protein S6 (rpsF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492634DOGYeast1mgQuote
EP492634DOGE. coli1mgQuote
BP492634DOGBaculovirus200ugQuote
MP492634DOGMammalian Cell200ugQuote

Protein Information

SpeciesArthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)
UniProt IDB8H841
Gene NamerpsF; Locus:Achl_3891
Protein Name30S ribosomal protein S6
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMRPYELMVIIDPEVEERTVEPSLQKFLNVITNDGGTIEKVDIWGRRRLAYDIKKKSEGIY AVVNFTAKPETAKELDRQLSLNETIMRTKITRPEEQKVVAE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review