Request QuoteCatalog Number: xP493243TNXSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP493243TNXYeast1mgQuote
EP493243TNXE. coli1mgQuote
BP493243TNXBaculovirus200ugQuote
MP493243TNXMammalian Cell200ugQuote

Protein Information

SpeciesThioalkalivibrio sp. (strain HL-EbGR7)
UniProt IDB8GV59
Gene NamerpsJ; Locus:Tgr7_2325
Protein Name30S ribosomal protein S10
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMSKQRIRIRLKAFDHRLIDRSASEIVETAKRTGARVKGPIPLPTKMERFTVLISPHVNKD ARDQYEIRTHKRLMDIMDPTDKTVDALMKLDLAAGVDVQIKLN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review