Request QuoteCatalog Number: xP513657TMTSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S24e (rps24e)

Recombinant 30S ribosomal protein S24e (rps24e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513657TMTYeast1mgQuote
EP513657TMTE. coli1mgQuote
BP513657TMTBaculovirus200ugQuote
MP513657TMTMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus sibiricus (strain MM 739 / DSM 12597)
UniProt IDC6A0F5
Gene Namerps24e; Locus:TSIB_0029
Protein Name30S ribosomal protein S24e
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMEIRVIDTKENKLLGRKEIYFEVIHEGEPTPSRADVKGKLVAMLDLNPEATVVQYIRSYF GSHVSEGYAKAYESKERMLYIEPEYVLRREGIIQEQEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review