Request QuoteCatalog Number: xP506765FMXSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP506765FMXYeast1mgQuote
EP506765FMXE. coli1mgQuote
BP506765FMXBaculovirus200ugQuote
MP506765FMXMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pneumoniae (strain 70585)
UniProt IDC1C6B6
Gene NamerpsP; Locus:SP70585_0817
Protein Name30S ribosomal protein S16
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWL ANGAQPSDTVRNILSKEGVLKKFHDSKFSK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review