Request QuoteCatalog Number: xP504760EPUSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504760EPUYeast1mgQuote
EP504760EPUE. coli1mgQuote
BP504760EPUBaculovirus200ugQuote
MP504760EPUMammalian Cell200ugQuote

Protein Information

SpeciesExiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
UniProt IDC4L601
Gene NamerpsP; Locus:EAT1b_2893
Protein Name30S ribosomal protein S16
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIEQVGHYNPVAKPEAEVRINEELALKW LADGAKPSDTVRNLFSKAGIMEKFHNAKNAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review