Request QuoteCatalog Number: xP504638EPUSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6 (rpsF)

Recombinant 30S ribosomal protein S6 (rpsF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504638EPUYeast1mgQuote
EP504638EPUE. coli1mgQuote
BP504638EPUBaculovirus200ugQuote
MP504638EPUMammalian Cell200ugQuote

Protein Information

SpeciesExiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
UniProt IDC4L008
Gene NamerpsF; Locus:EAT1b_1745
Protein Name30S ribosomal protein S6
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMRKYELLYIIRPSVDEEAKKALIERFNNVITENGGTVEKTTDMGKRRFAYEINKMREGHY VLLNIVAEPKAILETERLMKISDDVVRQMTTKDER
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review