Request QuoteCatalog Number: xP504497FPESize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S24e (rps24e)

Recombinant 30S ribosomal protein S24e (rps24e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504497FPEYeast1mgQuote
EP504497FPEE. coli1mgQuote
BP504497FPEBaculovirus200ugQuote
MP504497FPEMammalian Cell200ugQuote

Protein Information

SpeciesSulfolobus islandicus (strain M.16.4 / Kamchatka #3)
UniProt IDC4KIA8
Gene Namerps24e; Locus:M164_1718
Protein Name30S ribosomal protein S24e
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMESQAKVKISDKAEGIIERDVQNAVIGRREILLKVYHMGSGTPSRKDIIKAISQAFASQE NLVVVRKISTSYGAGISNVKLHIYKSREILEKIEPKYLLDRDAGTKQKKGGSKGGQGAKG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review