Request QuoteCatalog Number: xP504354HUGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504354HUGYeast1mgQuote
EP504354HUGE. coli1mgQuote
BP504354HUGBaculovirus200ugQuote
MP504354HUGMammalian Cell200ugQuote

Protein Information

SpeciesHamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
UniProt IDC4K7B4
Gene NamerpsS; Locus:HDEF_1862
Protein Name30S ribosomal protein S19
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMPRSLKKSFFVDRHLLKKVEKSAENNKDKKPIRTWSRRSTIFPEMIGLTIAIHNGRLHVP VFISDEMVSHKLGEFAPTRTYRGHVAADRKAKKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review