Request QuoteCatalog Number: xP504230HUGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S20 (rpsT)

Recombinant 30S ribosomal protein S20 (rpsT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504230HUGYeast1mgQuote
EP504230HUGE. coli1mgQuote
BP504230HUGBaculovirus200ugQuote
MP504230HUGMammalian Cell200ugQuote

Protein Information

SpeciesHamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
UniProt IDC4K3I3
Gene NamerpsT; Locus:HDEF_0369
Protein Name30S ribosomal protein S20
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMANIKSAKKRAIQSEKRRKHNASRRSMVRTFIKKVYAAISSGDKKAAETAFAQMQPIIDR HACKGLIHKNKAARHKSNLTAQINAMSEDSLLKKRRSEGCEFKAPEKPV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review