Request QuoteCatalog Number: xP451379BYISize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP451379BYIYeast1mgQuote
EP451379BYIE. coli1mgQuote
BP451379BYIBaculovirus200ugQuote
MP451379BYIMammalian Cell200ugQuote

Protein Information

SpeciesAmoebophilus asiaticus (strain 5a2)
UniProt IDB3EUD8
Gene NamerpsP; Locus:Aasi_0109
Protein Name
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLAKKGRKKLALYDIVVADQRAPRDGRFIEKLGNYNPNTNPSTVVLHEDKVIQWL FNGAQPTNTVKNILSSQGILLKRHLQIGVKKGAITQEEADKRFLVWKESKTQKPGKFKA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review