Request QuoteCatalog Number: xP471918OEDSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S21 (rpsU)

Recombinant 30S ribosomal protein S21 (rpsU) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP471918OEDYeast1mgQuote
EP471918OEDE. coli1mgQuote
BP471918OEDBaculovirus200ugQuote
MP471918OEDMammalian Cell200ugQuote

Protein Information

SpeciesOligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)
UniProt IDB6JC20
Gene NamerpsU; Locus:OCAR_5101, OCA5_c28630
Protein Name
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK KLQREGLLPSKPKPVFGADRGRGAAGGAGGAPRPAR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review