Request QuoteCatalog Number: xP462967MSVSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP462967MSVYeast1mgQuote
EP462967MSVE. coli1mgQuote
BP462967MSVBaculovirus200ugQuote
MP462967MSVMammalian Cell200ugQuote

Protein Information

SpeciesMethylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4) )
UniProt IDB3E0I8
Gene NamerpsS; Locus:Minf_0687
Protein Name
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMGRSLKKGPFVDSHLIEKIEKLGAAKKPIKTWSRRSMIIPDFVGHTFLVHNGRTFQSVYV TENMVGHRLGEFAPTRTFKKHGAHTEKASVK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review