Request QuoteCatalog Number: xP453197WBOSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP453197WBOYeast1mgQuote
EP453197WBOE. coli1mgQuote
BP453197WBOBaculovirus200ugQuote
MP453197WBOMammalian Cell200ugQuote

Protein Information

SpeciesWolbachia pipientis subsp. Culex pipiens (strain wPip)
UniProt IDB3CPY0
Gene NamerpsP; Locus:WP0525
Protein Name
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLARFGAKKRPFYRIVVADSRAPRDGRFIERIGQYDPMLPKDNKNRVVVKADRLK HWLSVGAQATERVMWFIKKGIVDLETESKKIEKKKVEKVQGQEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review